Protein coding transcript 118962

• Transcript: Ll_transcript_305853
• CDS coordinates: 1560-2198 (+)
• Peptide sequence: MTGGVTDGRDNTTNGLMWLRGGPGDQGVNSLNVKGVGLLPWMQQRLDPTLIGNNQNQQYQAVLAAADLRNAGSENLLRQQMMNFQQPFCPQQLGNSNPPLHLLQQQGIQQSVSHNILPPEAQSLTENLSQQLLQKPLINREDQAQKQQHTYHNLHLIQSFQTDQLHHSIMPSPSYSKQDFLDSNMKFSVSVSSGQNMLGSLCPDGRGNLLNLS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_305853

• Blastp: Auxin response factor 8 from Arabidopsis with 39.82% of identity
• Blastx: Auxin response factor 6 from Arabidopsis with 92.95% of identity
• Eggnog: auxin response factor(ENOG410YA3R)
• Kegg: Link to kegg annotations (AT5G37020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455755.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;