Protein coding transcript 118963

• Transcript: Ll_transcript_305854
• CDS coordinates: 1-600 (+)
• Peptide sequence: ELGIPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSLQPPAQELIARDLHDVEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRVSVGMRFRMLFETEESSVRRYL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_305854

• Blastp: Auxin response factor 12 from Oryza sativa with 92.96% of identity
• Blastx: Auxin response factor 12 from Oryza sativa with 92.96% of identity
• Eggnog: auxin response factor(ENOG410YA3R)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020991994.1)
• Pfam: B3 DNA binding domain (PF02362.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;