Protein coding transcript 118969

• Transcript: Ll_transcript_305867
• CDS coordinates: 2-694 (+)
• Peptide sequence: FLPMELGIPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSLQPPAQELIARDLHDVEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDE
• ORF Type: internal

Annotations of Ll_transcript_305867

• Blastp: Auxin response factor 6 from Arabidopsis with 92.21% of identity
• Blastx: Auxin response factor 6 from Arabidopsis with 92.21% of identity
• Eggnog: auxin response factor(ENOG410YA3R)
• Kegg: Link to kegg annotations (AT1G30330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020991994.1)
• Pfam: B3 DNA binding domain (PF02362.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;