Transcript | Ll_transcript_305869 |
---|---|
CDS coordinates | 1-696 (+) |
Peptide sequence | ELGIPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSLQPPAQELIARDLHDVEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWYIISFYLYFILFLPLELANCLCYCFLRFFIFRNEKNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRVSVGMRFRMLFETEESSVRRYL* |
ORF Type | 5prime_partial |
Blastp | Auxin response factor 6 from Arabidopsis with 80.09% of identity |
---|---|
Blastx | Auxin response factor 12 from Oryza sativa with 80.09% of identity |
Eggnog | auxin response factor(ENOG410YA3R) |
Kegg | Link to kegg annotations (AT1G30330) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020991994.1) |
Pfam | B3 DNA binding domain (PF02362.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer