Protein coding transcript 119015

• Transcript: Ll_transcript_307048
• CDS coordinates: 48-926 (+)
• Peptide sequence: MATTFCTYLIFLLSFTFTIFNLSSYSSPSESDTLLTFKASIQDSNNALSTWSNTSSNLYCNWTGISCSTTKPVSVTSINLQSLNLSGDISSSICDLPKISYLNLADNNFNEPIPLHLSQCTFLETLNLSKNLIWGTIPSQISQLGSLKVLDLSRNHIEGNIPESLGALKNLQVLNMGSNLLSSNVAAIFGNLTKLEVLDLSQNPNLVSEIPKDIGELGSLKQLLLQSSSFQGEIPSSLVGLHGLTHLDLSDNNLTGLVPKFLASSLKNLVSFDVSQNKLSGPFPNGICKGLVI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_307048

• Blastp: Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 from Arabidopsis with 63.22% of identity
• Blastx: Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 from Arabidopsis with 63.22% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G06940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454697.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;