Protein coding transcript 119073

• Transcript: Ll_transcript_304741
• CDS coordinates: 3303-3713 (+)
• Peptide sequence: MRFLIPFLGTVISGSILTAIFPSFACACGSLVVDVAENVPLLFSFFSTPLFVCVCGSLITIPSPFMTTLSSRLKLGKQSVISVKLSHVASAGVVFSHCTSTCGTICEPCLMDLVYRIAWGASTGPVGVVVSGKGMY*
• ORF Type: complete

Annotations of Ll_transcript_304741

• Blastp: Retrovirus-related Pol polyprotein from transposon 297 from Sophophora with 44.67% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon 297 from Sophophora with 44.5% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002914)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014627597.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;