Transcript | Ll_transcript_304741 |
---|---|
CDS coordinates | 3303-3713 (+) |
Peptide sequence | MRFLIPFLGTVISGSILTAIFPSFACACGSLVVDVAENVPLLFSFFSTPLFVCVCGSLITIPSPFMTTLSSRLKLGKQSVISVKLSHVASAGVVFSHCTSTCGTICEPCLMDLVYRIAWGASTGPVGVVVSGKGMY* |
ORF Type | complete |
Blastp | Retrovirus-related Pol polyprotein from transposon 297 from Sophophora with 44.67% of identity |
---|---|
Blastx | Retrovirus-related Pol polyprotein from transposon 297 from Sophophora with 44.5% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0002914) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014627597.1) |
Pfam | Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer