Protein coding transcript 119087

• Transcript: Ll_transcript_307290
• CDS coordinates: 1-837 (+)
• Peptide sequence: VLNQQVSASRKGFRNQIKNLWWRKGKEDGADSLNGPMYNYNSIESQIRVLGDYAFMLRDYELALSNYRLISTDYKIDKAWKRYAGVQEMMGLTYFMSDQSRKEAEYCMENAFNTYLKLGLPGQQNATRCGLWWVEMLKAWDQYKEAATVYFRICGEDTLHSAVMLEQASYCYLLSKPSMLRKYGFHLVLYGEQYKKCDQIKHAIRTYKSALSFFKGTTWSYIHDHVHFHIGQWYASLGMYDVAVKHMMEVLACSHQSKSTQELFVGDFLKAVEDGHLR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_307290

• Blastp: Trafficking protein particle complex subunit 8 from Homo with 35.59% of identity
• Blastx: Trafficking protein particle complex subunit 8 from Homo with 34.41% of identity
• Eggnog: trafficking protein particle complex(ENOG410XPCJ)
• Kegg: Link to kegg annotations (22878)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444202.1)
• Pfam: ER-Golgi trafficking TRAPP I complex 85 kDa subunit (PF12739.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;