Transcript | Ll_transcript_305635 |
---|---|
CDS coordinates | 335-1258 (+) |
Peptide sequence | MLSVLRVHLPSDIPIVGCELTPYVLIRRPDKTVTTDDLSQISPLDGHFLRYKWYRVQSDKKVAVCSVHPSEQATLQCIGCVKAKIPVAKSYHCTPKCFSDAWQHHRVLHDRAASAVNENGNEEEEVFGRFNNSGSGSLTSLSASASSASLTNGSAPLYPAAVTQRNGGETWFEVGRSKTYTPTADDIGHVLKFECVVVDAGTKLPVGYANSLLTSRVIPAPSPSPRRMITVDGMGHLDADGRITSSGTFTVLSYNILSDACASKNDLYSYCPSWALSWPYRRQNLLREIVGYCADIICLQELVLIKT* |
ORF Type | complete |
Blastp | Carbon catabolite repressor protein 4 homolog 2 from Arabidopsis with 69.71% of identity |
---|---|
Blastx | Carbon catabolite repressor protein 4 homolog 2 from Arabidopsis with 77.78% of identity |
Eggnog | Ccr4-NOT transcription complex, subunit(COG5239) |
Kegg | Link to kegg annotations (AT3G58580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444135.1) |
Pfam | zf-MYND-like zinc finger, mRNA-binding (PF15801.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer