Protein coding transcript 119119

• Transcript: Ll_transcript_305635
• CDS coordinates: 335-1258 (+)
• Peptide sequence: MLSVLRVHLPSDIPIVGCELTPYVLIRRPDKTVTTDDLSQISPLDGHFLRYKWYRVQSDKKVAVCSVHPSEQATLQCIGCVKAKIPVAKSYHCTPKCFSDAWQHHRVLHDRAASAVNENGNEEEEVFGRFNNSGSGSLTSLSASASSASLTNGSAPLYPAAVTQRNGGETWFEVGRSKTYTPTADDIGHVLKFECVVVDAGTKLPVGYANSLLTSRVIPAPSPSPRRMITVDGMGHLDADGRITSSGTFTVLSYNILSDACASKNDLYSYCPSWALSWPYRRQNLLREIVGYCADIICLQELVLIKT*
• ORF Type: complete

Annotations of Ll_transcript_305635

• Blastp: Carbon catabolite repressor protein 4 homolog 2 from Arabidopsis with 69.71% of identity
• Blastx: Carbon catabolite repressor protein 4 homolog 2 from Arabidopsis with 77.78% of identity
• Eggnog: Ccr4-NOT transcription complex, subunit(COG5239)
• Kegg: Link to kegg annotations (AT3G58580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444135.1)
• Pfam: zf-MYND-like zinc finger, mRNA-binding (PF15801.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;