Transcript | Ll_transcript_306244 |
---|---|
CDS coordinates | 1083-1502 (+) |
Peptide sequence | MAKILRSDDLPSCSSSPARMQGTFGYFAPEYAIVGRASLESDVFSFGVVLLELISGRHPIHKSMGKEESLVIWAVPRLRDSRRVIMELVDPKLNGNFQEEEVQIMAYLAKECLLLDPDTRPTMSEVVQVLCSISPGKSWS |
ORF Type | 3prime_partial |
Blastp | Receptor-like serine/threonine-protein kinase NCRK from Arabidopsis with 72.34% of identity |
---|---|
Blastx | Receptor-like serine/threonine-protein kinase NCRK from Arabidopsis with 70.68% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT2G28250) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448748.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer