Protein coding transcript 119197

• Transcript: Ll_transcript_305268
• CDS coordinates: 2-826 (+)
• Peptide sequence: NPLKHPPRLSFPSTHVSIIVSLKILRETEKKSETKMEGVKRYAVLMCAEDSDYVRNKHGGYFGVFVRMLAEEGERWDMYKVARGEFPEERELCLYDGFVITGSCNDAHGNDPWVHHLLNLLSKLNSMNKKILGICFGHQILGRALGGKVSRSPTGWDIGVRTITFSSSSLKLPSNLSIIECHRDEIRELPAKAEVIAWSEKTGIEMFKYEDHIMGIQGHPEYTKDILLHLIDRLIHHNFIMESFAVETKLKAEMWEPDTKAWQKLCLSFLKGQL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_305268

• Blastp: Gamma-glutamyl peptidase 5 from Arabidopsis with 48.35% of identity
• Blastx: Gamma-glutamyl peptidase 5 from Arabidopsis with 47.93% of identity
• Eggnog: Catalyzes the synthesis of GMP from XMP (By similarity)(COG0518)
• Kegg: Link to kegg annotations (AT2G23970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418260.1)
• Pfam: Glutamine amidotransferase class-I (PF00117.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;