Transcript | Ll_transcript_305824 |
---|---|
CDS coordinates | 3-734 (+) |
Peptide sequence | ISVLVTVGSEVAEKKLIDLGAVQRIIDLFFEYPYNNFLHHHVENIIMSCLESKNSFLVAHLLHDCDFVGKIIQAEKHFTLEADANKPTIPSEGKSPPRIGSIGHLTRISNKLGQLGNNNSVIQEHLQGNTEWTDWYADVLSKRNTVENVYQWACGRPTALHDRNRDSDDDDYQDRDYDVAALANNLSQAFRYGIYNNEDIEEVLSFLSSTWQSAFHCFIVYRPYHKRDTAGVSIESLFYQTSI* |
ORF Type | 5prime_partial |
Blastp | Serine/threonine-protein phosphatase 6 regulatory subunit 3 from Gallus with 27.52% of identity |
---|---|
Blastx | Serine/threonine-protein phosphatase 6 regulatory subunit 3 from Gallus with 29.38% of identity |
Eggnog | Protein phosphatase 6, regulatory subunit(ENOG410XRM1) |
Kegg | Link to kegg annotations (423116) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440103.1) |
Pfam | SIT4 phosphatase-associated protein (PF04499.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer