Protein coding transcript 1193

• Transcript: Ll_transcript_322276
• CDS coordinates: 2-313 (+)
• Peptide sequence: LKPKQQNKEVVEFLVHGFVGKKARTKNYHKPKCEVKWVKKRCSHCEAEETPQWRNGPMGPKTLCNACGVRYKSGRLVSDYRPANSSTFDSSIHSNYHRNIMKRR
• ORF Type: internal

Annotations of Ll_transcript_322276

• Blastp: GATA transcription factor 1 from Arabidopsis with 68.66% of identity
• Blastx: GATA transcription factor 1 from Arabidopsis with 68.66% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT3G24050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435888.1)
• Pfam: GATA zinc finger (PF00320.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;