Protein coding transcript 119336

• Transcript: Ll_transcript_306816
• CDS coordinates: 45-773 (+)
• Peptide sequence: MYVNLNHLRYMSAAFVEKMQKTGDLNLIGQFGVGFYSVYLVADYVEVISKHNDDKQYVWESKADGAFAISEDTWNEPLGRGTEIRIHLRDEASEYLEEFNLKELVKRYSEFINFPINLWASKEVDVEVPADVDETSEEEESSKTSSEEENENEDEDGEKQPKTKTVKQTTHEWEVLNNVKAIWLRNPKDVTDEEYNKFYHTLAKHGVTLLRKVMLSSRLSCLCHLKLLVIYMILIIMHINRT*
• ORF Type: complete

Annotations of Ll_transcript_306816

• Blastp: Endoplasmin homolog from Hordeum with 78.24% of identity
• Blastx: Endoplasmin homolog from Arabidopsis with 69.59% of identity
• Eggnog: Molecular chaperone. Has ATPase activity (By similarity)(COG0326)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415505.1)
• Pfam: Hsp90 protein (PF00183.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;