Protein coding transcript 119345

• Transcript: Ll_transcript_306801
• CDS coordinates: 50-874 (+)
• Peptide sequence: MRKWTLPSILLLLSLLLLFSDQGQKLKANAEANSEELVDPPKVEDKIGAVPHGLSTDSDVAKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQTSGDLNLIGQFGVGFYSVYLVADYVEVISKHNDDKQYVWESKADGAFAISEDTWNEPLGRGTEIRLHLKDEAGEYLEESKLKVGTKLLP*
• ORF Type: complete

Annotations of Ll_transcript_306801

• Blastp: Endoplasmin homolog from Catharanthus with 88.39% of identity
• Blastx: Endoplasmin homolog from Catharanthus with 88.39% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453253.1)
• Pfam: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;