Transcript | Ll_transcript_306311 |
---|---|
CDS coordinates | 309-695 (+) |
Peptide sequence | MACNYPLIFLMLYSMMHRFDKIINKEIPSTVVYEDDKVFAFRDITPQAPTHILIIPKVKDGLTGLSKAEERHCEILGHLLYTAKLVAKQEGLDDGFRIVINDGPRGCQSVYHIHVHLIGGRQMNWPPG* |
ORF Type | complete |
Blastp | Adenylylsulfatase HINT1 from Arabidopsis with 88.18% of identity |
---|---|
Blastx | Adenylylsulfatase HINT1 from Arabidopsis with 88.18% of identity |
Eggnog | histidine triad (hIT) protein(COG0537) |
Kegg | Link to kegg annotations (AT3G56490) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451379.1) |
Pfam | Scavenger mRNA decapping enzyme C-term binding (PF11969.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer