Protein coding transcript 119427

• Transcript: Ll_transcript_306319
• CDS coordinates: 52-525 (+)
• Peptide sequence: MNEERKISERISVLSSHFNSSNSISMATEKQAALAATPPSHAHSPTIFDKIINKEIPSTVVYEDDKVFAFRDITPQAPTHILIIPKVKDGLTGLSKAEERHCEILGHLLYTAKLVAKQEGLDDGFRIVINDGPRGCQSVYHIHVHLIGGRQMNWPPG*
• ORF Type: complete

Annotations of Ll_transcript_306319

• Blastp: Adenylylsulfatase HINT1 from Arabidopsis with 79.47% of identity
• Blastx: Adenylylsulfatase HINT1 from Arabidopsis with 84.85% of identity
• Eggnog: histidine triad (hIT) protein(COG0537)
• Kegg: Link to kegg annotations (AT3G56490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451379.1)
• Pfam: Scavenger mRNA decapping enzyme C-term binding (PF11969.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;