Protein coding transcript 119441

• Transcript: Ll_transcript_306314
• CDS coordinates: 322-1299 (+)
• Peptide sequence: MAKESSYAPEDRLLRAILGIQVSTSKETCLKLPIGGRGRVIDVRWIHKKGVSSYNPETIRIYILQKREIKVGDKVAGRHGNKGIVSIILSRQDMPYLQDGRPVDMVFNPLGVPSRMNVGQIFECSLGLAGFMLDRHYRIAPFDERYEQEASRKLVFSELYEASKQTANPWIFEPEYPGKSRIVDGRTGNLFEQPVLMGKPYILKLIHQVDDKIHGRSSGHYALVTQQPLRGRAKQGGQRVGEMEVWALEGFGVAHILQEMLTYKSDHIKARQEVLGITIIGGTIPKPADAPESFRLLVRELRSLALELNHFLISEKNFRIHRKEA*
• ORF Type: complete

Annotations of Ll_transcript_306314

• Blastp: DNA-directed RNA polymerase subunit beta from Soja with 93.85% of identity
• Blastx: DNA-directed RNA polymerase subunit beta from Soja with 93.09% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG0085)
• Kegg: Link to kegg annotations (3989291)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (YP_008963597.1)
• Pfam: RNA polymerase Rpb2, domain 6 (PF00562.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;