Transcript | Ll_transcript_306337 |
---|---|
CDS coordinates | 3-1298 (+) |
Peptide sequence | DGAATVGGELALGKNVLVAYMPWEGYNFEDAVLISERLVYEDIYTSFHIRKYEIQTHVTSHGPERITNEIPHLEAHLLQNLDKNGIVILGSWVESGDILVGKLTPQMAKESSYAPEDRLLRAILGIQVSTSKETCLKLPIGGRGRVIDVRWIHKKGVSSYNPETIRIYILQKREIKVGDKVAGRHGNKGIVSIILSRQDMPYLQDGRPVDMVFNPLGVPSRMNVGQIFECSLGLAGFMLDRHYRIAPFDERYEQEASRKLVFSELYEASKQTANPWIFEPEYPGKSRIVDGRTGNLFEQPVLMGKPYILKLIHQVDDKIHGRSSGHYALVTQQPLRGRAKQGGQRVGEMEVWALEGFGVAHILQEMLTYKSDHIKARQEVLGITIIGGTIPKPADAPESFRLLVRELRSLALELNHFLISEKNFRIHRKEA* |
ORF Type | 5prime_partial |
Blastp | DNA-directed RNA polymerase subunit beta from Gossypium with 93.04% of identity |
---|---|
Blastx | DNA-directed RNA polymerase subunit beta from Gossypium with 93.04% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (3989197) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (YP_008963597.1) |
Pfam | RNA polymerase Rpb2, domain 6 (PF00562.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer