Protein coding transcript 119518

• Transcript: Ll_transcript_306464
• CDS coordinates: 3-434 (+)
• Peptide sequence: SSRSKVDSSVSGTSTNYAESKSTNDTSRGQPVVPVVSSTSTSNTESISSSSKFEEEMKVASRLRKFAFNDLKLATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNFLGDLVHPNL
• ORF Type: internal

Annotations of Ll_transcript_306464

• Blastp: Probable serine/threonine-protein kinase PIX7 from Arabidopsis with 69.59% of identity
• Blastx: Probable serine/threonine-protein kinase PIX7 from Arabidopsis with 77.78% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G15080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455641.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;