Protein coding transcript 119520

• Transcript: Ll_transcript_306472
• CDS coordinates: 357-1097 (+)
• Peptide sequence: MGKVLESLDVSKSKENKKKKKKNEVLEEEEEKSVRCWLRFRFFGSCISSRSNVDGSLSGTNTHYAENKSTNDTSRDQPTVPVVSSTSTSNSSNSLSSKLEEELKVSSRLRKFTFNDLKLATTNFRPESLLGESGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLVGVNFFGGLVHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHLFRSKLVFFLTNFLILLVISNFWTNTAT*
• ORF Type: complete

Annotations of Ll_transcript_306472

• Blastp: Probable serine/threonine-protein kinase PIX7 from Arabidopsis with 67.11% of identity
• Blastx: Probable serine/threonine-protein kinase PIX7 from Arabidopsis with 75.58% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G15080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455641.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;