Transcript | Ll_transcript_307167 |
---|---|
CDS coordinates | 397-741 (+) |
Peptide sequence | MSFSITQHPLSSNNFLQQNVTMSAVAARSFIRSAASRTANFAASSRPSPTRSPFQIPKQSSISNRTFRSPVALSFCVESMLPYHTATASALLTSMLSACPRSYGWTLEGQEKTR* |
ORF Type | complete |
Blastp | Protein NUCLEAR FUSION DEFECTIVE 6, chloroplastic/mitochondrial from Arabidopsis with 52.31% of identity |
---|---|
Blastx | Protein NUCLEAR FUSION DEFECTIVE 6, chloroplastic/mitochondrial from Arabidopsis with 69.23% of identity |
Eggnog | NA(ENOG410ZH16) |
Kegg | Link to kegg annotations (AT2G20585) |
CantataDB | Link to cantataDB annotations (CNT0002336) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425331.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer