Protein coding transcript 119585

• Transcript: Ll_transcript_307149
• CDS coordinates: 397-741 (+)
• Peptide sequence: MSFSITQHPLSSNNFLQQNVTMSAVAARSFIRSAASRTANFAASSRPSPTRSPFQIPKQSSISNRTFRSPVALSFCVESMLPYHTATASALLTSMLSACPRSYGWTLEGQEKTR*
• ORF Type: complete

Annotations of Ll_transcript_307149

• Blastp: Protein NUCLEAR FUSION DEFECTIVE 6, chloroplastic/mitochondrial from Arabidopsis with 52.31% of identity
• Blastx: Protein NUCLEAR FUSION DEFECTIVE 6, chloroplastic/mitochondrial from Arabidopsis with 69.23% of identity
• Eggnog: NA(ENOG410ZH16)
• Kegg: Link to kegg annotations (AT2G20585)
• CantataDB: Link to cantataDB annotations (CNT0002336)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425331.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;