| Transcript | Ll_transcript_322313 |
|---|---|
| CDS coordinates | 118-453 (+) |
| Peptide sequence | MDSKPWLIVLLLALALMVAAEASVMHEYGRGALSGGDIDLITDDNEFLMSSEIARRTLLGRRRYIGYNALRANRVPCGQRGCSYYNCQQRGRANPYRRGCTAITHCARNVN* |
| ORF Type | complete |
| Blastp | Protein RALF-like 4 from Arabidopsis with 50% of identity |
|---|---|
| Blastx | Protein RALF-like 19 from Arabidopsis with 58.9% of identity |
| Eggnog | hormone activity(ENOG410ZNB7) |
| Kegg | Link to kegg annotations (AT1G28270) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425275.1) |
| Pfam | Rapid ALkalinization Factor (RALF) (PF05498.10) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer