Protein coding transcript 119892

• Transcript: Ll_transcript_487577
• CDS coordinates: 1-903 (+)
• Peptide sequence: KQDHSGEQLANTNVSPASGMEQSNGRTSIGNASGPAATPSRTGNVSVEGGHDLPSEVGDCTRHGTSTNGAVTEGIGVNRHKEVSVQHFKGDREEGELSPNVDFEEDNFRVYGDGSSDVLHKAKNGGLSQQYQNRHREEAFGEAKGENYANADDEGEESRHRSSGDIGNASVNDVSGSESAGGEDCSREDHEDGEHDNKAESEGEAEGMGDAHDVEGDGTSLPLSEHFLLTVKPLAKHVPPVLHVKEWNSQVFYGTDSFYVLFRLHQTLYERIRSAKINSSSAERKWGASNDTNSRDQYDR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_487577

• Blastp: Paired amphipathic helix protein Sin3-like 3 from Arabidopsis with 45.95% of identity
• Blastx: Paired amphipathic helix protein Sin3-like 4 from Arabidopsis with 51.54% of identity
• Eggnog: Paired AMPhipathic helix protein(COG5602)
• Kegg: Link to kegg annotations (AT1G24190)
• CantataDB: Link to cantataDB annotations (CNT0002810)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445513.1)
• Pfam: C-terminal domain of Sin3a protein (PF16879.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;