Protein coding transcript 119893

• Transcript: Ll_transcript_487578
• CDS coordinates: 246-959 (+)
• Peptide sequence: MNALYNLLDGSSDNAKFEDDCRAVIGTQSYLLFTLDQLIYKLVKQLQAVATDEMDNKLLQLYAYEKSRKPGRFFDVVYHDNARVLLHDENIYRIEYSPGPMQMSIQLMDHGHDKPEVTAVSVDPNFSAYLHNNFLSVVPDNKEKSGIFLKRNKRRYAHDDEFSSQVMEELKVVNGLECKIACSSSKVSYVLDTEDFLVRMRRKRRALHPKSSCHEQAKSSSIFSRRVQRLRRLFSSQ*
• ORF Type: complete

Annotations of Ll_transcript_487578

• Blastp: Paired amphipathic helix protein Sin3-like 4 from Arabidopsis with 63.22% of identity
• Blastx: Paired amphipathic helix protein Sin3-like 4 from Arabidopsis with 60.45% of identity
• Eggnog: Paired AMPhipathic helix protein(COG5602)
• Kegg: Link to kegg annotations (AT1G70060)
• CantataDB: Link to cantataDB annotations (CNT0002810)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423158.1)
• Pfam: C-terminal domain of Sin3a protein (PF16879.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;