Protein coding transcript 119984

• Transcript: Ll_transcript_485248
• CDS coordinates: 238-810 (+)
• Peptide sequence: MSKARVYTDINVLRPKEYWDYESLTVQWGDQDDYEVVRKVGRGKYSEVFEGINVNSNERCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEHVNSTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGQEYNVRVASR*
• ORF Type: complete

Annotations of Ll_transcript_485248

• Blastp: Casein kinase II subunit alpha from Zea with 95.26% of identity
• Blastx: Casein kinase II subunit alpha-1 from Arabidopsis with 82.38% of identity
• Eggnog: Casein Kinase(ENOG410XNPP)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001242864.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;