Protein coding transcript 119990

• Transcript: Ll_transcript_485255
• CDS coordinates: 868-1425 (+)
• Peptide sequence: MHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIARVLGTDELNAYLNKYHLELDPQLDSLVGRHSRKPWSKFISADNQHLVSPEAIDFLDKLLRYDHQDRLTAQEAMAHPYFSQVRAAESSRMRT*
• ORF Type: complete

Annotations of Ll_transcript_485255

• Blastp: Casein kinase II subunit alpha-1 from Arabidopsis with 94.05% of identity
• Blastx: Casein kinase II subunit alpha-2 from Oryza sativa with 94.22% of identity
• Eggnog: Casein Kinase(ENOG410XNPP)
• Kegg: Link to kegg annotations (AT5G67380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020978591.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;