Protein coding transcript 119992

• Transcript: Ll_transcript_485257
• CDS coordinates: 315-995 (+)
• Peptide sequence: MSKARVYTDINVLRPKEYWDYESLTVQWGDQDDYEVVRKVGRGKYSEVFEGINVNSNDRCVIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDEHSKTPSLIFEYVNSTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLLDHDYSLDMWSLGCMFAAMVGIIAS*
• ORF Type: complete

Annotations of Ll_transcript_485257

• Blastp: Casein kinase II subunit alpha from Zea with 93.67% of identity
• Blastx: Casein kinase II subunit alpha-1 from Arabidopsis with 90.09% of identity
• Eggnog: Casein Kinase(ENOG410XNPP)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003524685.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;