Protein coding transcript 119996

• Transcript: Ll_transcript_485263
• CDS coordinates: 1-315 (+)
• Peptide sequence: GPNIVKLLDIVRDQHSKTPSLIFEYVNSTDFKVLYPTLTDYDIRYYIYELLKALDFCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASR
• ORF Type: internal

Annotations of Ll_transcript_485263

• Blastp: Casein kinase II subunit alpha-1 from Arabidopsis with 99.05% of identity
• Blastx: Casein kinase II subunit alpha-1 from Arabidopsis with 99.05% of identity
• Eggnog: Casein Kinase(ENOG410XNPP)
• Kegg: Link to kegg annotations (AT5G67380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020978591.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;