Protein coding transcript 119998

• Transcript: Ll_transcript_485266
• CDS coordinates: 238-960 (+)
• Peptide sequence: MSKARVYTDINVLRPKEYWDYESLTVQWGDQDDYEVVRKVGRGKYSEVFEGINVNSNERCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDEHSKTPSLIFEYVNSTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLEDYDYSLDMWSLGCMFAGMIFRKEPFFYGRDNQDQLVKIA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_485266

• Blastp: Casein kinase II subunit alpha-2 from Oryza sativa with 95.44% of identity
• Blastx: Casein kinase II subunit alpha-1 from Arabidopsis with 85.25% of identity
• Eggnog: Casein Kinase(ENOG410XNPP)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017436991.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;