Protein coding transcript 120098

• Transcript: Ll_transcript_485142
• CDS coordinates: 204-518 (+)
• Peptide sequence: MADTETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKSKLDAQPELFIHLVPDKTNNSLSIIDSGIGMTKAGKIALFLILVISVCVA*
• ORF Type: complete

Annotations of Ll_transcript_485142

• Blastp: Heat shock protein 90-4 from Arabidopsis with 90.91% of identity
• Blastx: Heat shock protein 90-3 from Arabidopsis with 75% of identity
• Eggnog: Molecular chaperone. Has ATPase activity (By similarity)(COG0326)
• Kegg: Link to kegg annotations (AT5G56000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435703.1)
• Pfam: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;