Protein coding transcript 120107

• Transcript: Ll_transcript_485152
• CDS coordinates: 2-325 (+)
• Peptide sequence: YSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLYLKEDQLEYLEERRLKDLVKKHSEFISYPISLWVEKTTEKEVSGDEDEEGKKDEEGK
• ORF Type: internal

Annotations of Ll_transcript_485152

• Blastp: Heat shock protein 83 from Ipomoea with 89.36% of identity
• Blastx: Heat shock cognate protein 80 from Lycopersicon with 94.32% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (109146489)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447045.1)
• Pfam: Hsp90 protein (PF00183.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;