Protein coding transcript 120108

• Transcript: Ll_transcript_485153
• CDS coordinates: 1-303 (+)
• Peptide sequence: EDEEEKKDEEGKVEDVDEEKEKEEKKKKTIKEVSHEWDLVNKQKPIWMRKPEEITKEEYAAFYKSLTNDWEEHLAVKHFSVEGQLEFKAVLFVPKRVPFDL
• ORF Type: internal

Annotations of Ll_transcript_485153

• Blastp: Heat shock protein 81-1 from Oryza sativa with 97.06% of identity
• Blastx: Heat shock protein 81-1 from Oryza sativa with 97.06% of identity
• Eggnog: Molecular chaperone. Has ATPase activity (By similarity)(COG0326)
• Kegg: Link to kegg annotations (4345951)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447045.1)
• Pfam: Hsp90 protein (PF00183.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;