Transcript | Ll_transcript_485155 |
---|---|
CDS coordinates | 2-679 (+) |
Peptide sequence | DEEGKVEAVDEEQEKEEKKKKTIKEVSHEWDLVNKQKPIWMRKPEEITKEEYAAFYKSLTNDWEEHLAVKHFSVEGQLEFKAVLFVPKRAPFDLFDTKKKPNNIKLYVRRVFIMDNCEDLIPEYLGFVKGIVDSEDLPLNISRETLQQNKILKVIRKNLVKKCLELFFEIAENKEDYNKFYEAFSKNLKLGIHEDSSNKAKIAELLRYHSTKGGAEQTSHKDYVTR |
ORF Type | internal |
Blastp | Heat shock protein 90-2 from Arabidopsis with 94.5% of identity |
---|---|
Blastx | Heat shock protein 90-2 from Arabidopsis with 94.5% of identity |
Eggnog | Molecular chaperone. Has ATPase activity (By similarity)(COG0326) |
Kegg | Link to kegg annotations (AT5G56030) |
CantataDB | Link to cantataDB annotations (CNT0000451) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447045.1) |
Pfam | Hsp90 protein (PF00183.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer