Protein coding transcript 120210

• Transcript: Ll_transcript_486989
• CDS coordinates: 690-1118 (+)
• Peptide sequence: MIQSKELFETMIKHPCFKDTPFVLILNKYDTFEEKISRVSLNACEWFHDFCPMRAHHNNQSLAHQAYFYVAMKFKELYASITGRKLFVSQAKARDRVTVDEAFKYIKEVLKWDEEKEENYYGPPEDSFYSTDISSSPYVRQE*
• ORF Type: complete

Annotations of Ll_transcript_486989

• Blastp: Extra-large guanine nucleotide-binding protein 3 from Arabidopsis with 74.13% of identity
• Blastx: Extra-large guanine nucleotide-binding protein 3 from Arabidopsis with 74.66% of identity
• Eggnog: Guanine nucleotide binding protein (G protein) alpha(ENOG410XNVQ)
• Kegg: Link to kegg annotations (AT1G31930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421491.1)
• Pfam: G-protein alpha subunit (PF00503.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;