Protein coding transcript 120326

• Transcript: Ll_transcript_487403
• CDS coordinates: 1034-1513 (+)
• Peptide sequence: MRYSTSLIGGPATLATFVAVYALFGPTYPGVYDRERGVYTLFYPGLSFAFPIPSQYTECCHNGGVELPLEFPDGTTPVTCRVSIYDSSSGKKVGVGSLMDKASAPPLPPGSIYMEEVHVKLGEELYFTVGTQHIPFGASPQDVWTELGRPCGIHQKQVP*
• ORF Type: complete

Annotations of Ll_transcript_487403

• Blastp: UPF0183 protein At3g51130 from Arabidopsis with 83.54% of identity
• Blastx: UPF0183 protein At3g51130 from Arabidopsis with 83.72% of identity
• Eggnog: Chromosome 16 open reading frame 70(ENOG410XT40)
• Kegg: Link to kegg annotations (AT3G51130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422128.1)
• Pfam: Uncharacterised protein family (UPF0183) (PF03676.13)
• Rfam: -
• GO: -