| Transcript | Ll_transcript_487405 |
|---|---|
| CDS coordinates | 911-1534 (+) |
| Peptide sequence | MDKASAPPLPPGSIYMEEVHVKLGEELYFTVGTQHIPFGASPQDVWTELGRPCGIHQKQVDQMVIHSASDLRPRTTLCGDYFYNYFTRGLDILFDGQTHKIKKFVLHTNYPGHADFNSYAKCNFVIHGSDSVEGPFQEVHNSKQRAITTSTKWDQVKEIFGGCVRAAIQTQGYGSNPFGSTLVYGYQNIAFEVMKNGYIATITLFRS* |
| ORF Type | complete |
| Blastp | UPF0183 protein At3g51130 from Arabidopsis with 79.33% of identity |
|---|---|
| Blastx | UPF0183 protein At3g51130 from Arabidopsis with 77.14% of identity |
| Eggnog | Chromosome 16 open reading frame 70(ENOG410XT40) |
| Kegg | Link to kegg annotations (AT3G51130) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422128.1) |
| Pfam | Uncharacterised protein family (UPF0183) (PF03676.13) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer