Protein coding transcript 12036

• Transcript: Ll_transcript_411106
• CDS coordinates: 83-559 (+)
• Peptide sequence: MSGSVCYKCNEPGHYARECQVGGGGGGYGSRGGGGGGGSGGGRDKCYKCNRFGHFARECKEDQDRCYRCNGVGHIARDCNQSPNEPSCYNCSKTGHISRDCPEQRDGGYGGGGRSSMACYNCNKSGHMARDCPEGQVKSCYSCGKTGHLSRECDKEGR*
• ORF Type: complete

Annotations of Ll_transcript_411106

• Blastp: CCHC-type zinc finger protein CG3800 from Sophophora with 54.55% of identity
• Blastx: CCHC-type zinc finger protein CG3800 from Sophophora with 53.66% of identity
• Eggnog: zinc finger(COG5082)
• Kegg: Link to kegg annotations (Dmel_CG3800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020963505.1)
• Pfam: Zinc knuckle (PF14392.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;