Protein coding transcript 120412

• Transcript: Ll_transcript_486412
• CDS coordinates: 149-643 (+)
• Peptide sequence: MYYDIWFESQSTQPFFYWLDIGDGKEINLEKCPRSTLQRQCIKYLAPNEREEYEVIVENGKLVFRQDGRLVDTDDKSKWIFVLSTTRALYVGRKQKGKFQHSSFLSGGATTAAGRLVAHQGALEAIWPYSGHYHPTEENFKEFINFLEEHKVDLSNVKRCAIDDD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_486412

• Blastp: IQ domain-containing protein IQM1 from Arabidopsis with 71.95% of identity
• Blastx: IQ domain-containing protein IQM1 from Arabidopsis with 73.45% of identity
• Eggnog: calmodulin-binding family(ENOG4111I0K)
• Kegg: Link to kegg annotations (AT4G33050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442948.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;