Protein coding transcript 12056

• Transcript: Ll_transcript_411242
• CDS coordinates: 1-306 (+)
• Peptide sequence: MKAVTASECPHCNRMFCAQCKGSWHAGLACSEFQNLKDGVQKKEDQMVLELAKNNRWRRCSKCQFFVEKNEGCAHISCRCGNQFCYACGASWTHNHRCSYQ*
• ORF Type: complete

Annotations of Ll_transcript_411242

• Blastp: E3 ubiquitin-protein ligase RNF216 from Homo with 38.3% of identity
• Blastx: E3 ubiquitin-protein ligase RNF216 from Homo with 38.3% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (54476)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455182.1)
• Pfam: IBR domain, a half RING-finger domain (PF01485.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;