Transcript | Ll_transcript_485211 |
---|---|
CDS coordinates | 3-1085 (+) |
Peptide sequence | RLVILRHDEDNIVSSHILCNNAGALFVHAVVSDNTCVSDIINSKYVPPFLHSFFPLSRTKNYEGTSLPLLAVQITELVDGLFIGMTVNHVVADGKSFWHFINSWAEISRGCDVVSKLPSLDRWFLHPNRCPIRFPFNEDGQMEKSEDCTNYERIFHFSKEKIAKIKSKANSEAGTDKVSSLQALLTHLWRTVIRNQQLDPENECTIRLAVEVRRKIVPPLPDSYFGNALVVDDITMKAGELLLEGGLGKVALEMNKMIASFSDEKLKILYESWVGPPKFLLRGLNNTFGVSNSPRFNVYGNDFGWGKPLAVRSGSTSTKNGYTVLFAGPEEGSIDLTLSLPYEVLEAIGNDPHFMDPFST* |
ORF Type | 5prime_partial |
Blastp | Uncharacterized acetyltransferase At3g50280 from Arabidopsis with 39.51% of identity |
---|---|
Blastx | Uncharacterized acetyltransferase At3g50280 from Arabidopsis with 38.69% of identity |
Eggnog | Transferase Family(ENOG410YEZS) |
Kegg | Link to kegg annotations (AT3G50280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459819.1) |
Pfam | Transferase family (PF02458.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer