Protein coding transcript 120594

• Transcript: Ll_transcript_485218
• CDS coordinates: 3-536 (+)
• Peptide sequence: GKSLWHFINSWSEISRGCDVVSKLPSLERWFLHPNCCPIRFPILEEDVQIEKFEDCTNYDRIFHFTKEKIAKIKSKANEEADTDKISSLQALLTHLWRTTIRNQQLDPEKECSILVGIDTRGRIVPPLPDSYFGNALVVDVIRKKAGELLLEGGLGKVALEMHKMIASYSDEKLKILY
• ORF Type: internal

Annotations of Ll_transcript_485218

• Blastp: Protein ENHANCED PSEUDOMONAS SUSCEPTIBILTY 1 from Arabidopsis with 36.16% of identity
• Blastx: Protein ENHANCED PSEUDOMONAS SUSCEPTIBILTY 1 from Arabidopsis with 35.59% of identity
• Eggnog: Transferase family(ENOG411040Y)
• Kegg: Link to kegg annotations (AT5G67160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459819.1)
• Pfam: Transferase family (PF02458.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;