Protein coding transcript 12062

• Transcript: Ll_transcript_410963
• CDS coordinates: 383-724 (+)
• Peptide sequence: MSGEDEDPERKGLNLKQYSWRTNFQRDLIAGAMMGGMVHTVVAPIERAKLLLQTQESNLAIVASGRRKFKGMVDCIVRTVREEGILSLWRGNGSSVLRYYPSVALNFSLKVSS*
• ORF Type: complete

Annotations of Ll_transcript_410963

• Blastp: Probable ADP,ATP carrier protein At5g56450 from Arabidopsis with 69.3% of identity
• Blastx: Probable ADP,ATP carrier protein At5g56450 from Arabidopsis with 77.51% of identity
• Eggnog: transmembrane transport(ENOG410XNW0)
• Kegg: Link to kegg annotations (AT5G56450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437845.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;