Transcript | Ll_transcript_487305 |
---|---|
CDS coordinates | 3-398 (+) |
Peptide sequence | RRKLDITARAAGASKTIEAEVDKPLGLTLGQKPSGGVVITAVEGGGNAAKAGLKAGDQVLYTSSFFGDELWPADKLGFTKTAIQAKPDSVYFVVSRFSLSLFAMDLCSNFVIPLFLSNIGHSIADIVWNLT* |
ORF Type | 5prime_partial |
Blastp | Protein MET1, chloroplastic from Arabidopsis with 40.3% of identity |
---|---|
Blastx | - |
Eggnog | NA(ENOG410ZEH3) |
Kegg | Link to kegg annotations (AT1G55480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444605.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer