Protein coding transcript 120677

• Transcript: Ll_transcript_487346
• CDS coordinates: 258-611 (+)
• Peptide sequence: MSCFIDLNSDGAAALVLVSEQKARELGLRVIAKIKGYADAAQAPELFPTAPTLAIPKAISNAGLEASQIDYYEINEAFSVRKTSWILLSGLYVSLVFLHHLCRLWLLQIRSFLVLIR*
• ORF Type: complete

Annotations of Ll_transcript_487346

• Blastp: Probable acetyl-CoA acetyltransferase, cytosolic 2 from Arabidopsis with 83.33% of identity
• Blastx: Probable acetyl-CoA acetyltransferase, cytosolic 2 from Arabidopsis with 83.33% of identity
• Eggnog: acetyl-coa acetyltransferase(COG0183)
• Kegg: Link to kegg annotations (AT5G47720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434944.1)
• Pfam: Thiolase, C-terminal domain (PF02803.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;