Protein coding transcript 120695

• Transcript: Ll_transcript_485483
• CDS coordinates: 71-616 (+)
• Peptide sequence: MDHQPPSTTTTEKSHTLKLGTRHPSYRGVRKRRWGKWVSEIREPRKKSRIWLGSFPLPEMAAKAYDVAAYCLKGRKAQLNFPDEVECLPLPASSAPRDIQAAAAKAANMINKDKTSDGDSGADDFWGEIELPELANGECCLSSSSSTTGSTSWASSGGGGDITVWSSEVEILQQQQFMACL*
• ORF Type: complete

Annotations of Ll_transcript_485483

• Blastp: Ethylene-responsive transcription factor ERF023 from Arabidopsis with 54.55% of identity
• Blastx: Ethylene-responsive transcription factor ERF023 from Arabidopsis with 55.26% of identity
• Eggnog: Transcription factor(ENOG41118MR)
• Kegg: Link to kegg annotations (AT1G01250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440450.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;