Protein coding transcript 120711

• Transcript: Ll_transcript_487349
• CDS coordinates: 213-1385 (+)
• Peptide sequence: MASSTTTTQVYINVIEDVMVKVRDEFVNNAGPGYQVLKDLQAMWESKMMQVGVIVGPIERSTVPRPTPGGPITPVHDLNMPYEGTEEYETPTAEILFPPTPLQTPIQTPLPGTGDNSMYNIPTGPSDYSSSGNVTGGNTDPKGGRPSPYMQPPSPWMNHRPPLDVNVAYVEGRDEVDRGTSNQHLTQDFFAMPPGKRKRDDLASQYNAGGYIPQQDGSGDIASGVFEIEVNGGSISISAQHTTLKGNMSADLERPLSRIPQLDGPIPYEDDALSTPNIYNYGGVFSEDYNVANTPAPPEIPASTPALVAENEAENDDDADDDEPPLNENDDDDLDDLEQGDDQNTHHLVLAQFDKVSRTKSRWKCTLKDGIMHINNKDILFNKATGEFDF*
• ORF Type: complete

Annotations of Ll_transcript_487349

• Blastp: Transcription initiation factor IIA large subunit from Schizosaccharomyces with 24.75% of identity
• Blastx: Transcription initiation factor IIA subunit 1 from Dictyostelium with 62.79% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC28F2.09)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448333.1)
• Pfam: Transcription factor IIA, alpha/beta subunit (PF03153.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;