| Transcript | Ll_transcript_322307 |
|---|---|
| CDS coordinates | 78-377 (+) |
| Peptide sequence | MESTKSESYFVFMNYDPEYQRLLNDRTKRGAHELDLYLSTKHDEVLRSTLEPGSYKKTCSFVIVDGFAVEITEDQANVLRSAKEVRVVEKNEEFPECIA* |
| ORF Type | complete |
| Blastp | Subtilisin-like protease SBT2.5 from Arabidopsis with 42.86% of identity |
|---|---|
| Blastx | - |
| Eggnog | peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404) |
| Kegg | Link to kegg annotations (AT2G19170) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019423271.1) |
| Pfam | Peptidase inhibitor I9 (PF05922.15) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer