Protein coding transcript 120833

• Transcript: Ll_transcript_486805
• CDS coordinates: 235-1017 (+)
• Peptide sequence: MSSTLEIEARDVIKIVLQFCKENSLHQTFQTLQNECQVSLNTVDSNETFVADINSGRWDAILPQVSQLKLPRNNLEDLYEQIVLEMIELRELDTARSILRQTQVMGVMKQEQPERYLRLEHLLVRTYFDPNEAYQDSTKEKRRALIAQAIAAQVTVVPPSRLMALIGQALKWQQHQGLLPPGTQFDLFRGTAAMKQDVDDMYPTTLSHTIKFGTKSHAESACFSPDGQFLVSCSVDGFIEVWDYISGKLKKDLQYQADVS*
• ORF Type: complete

Annotations of Ll_transcript_486805

• Blastp: Suppressor of mec-8 and unc-52 protein homolog 1 from Arabidopsis with 87.5% of identity
• Blastx: Suppressor of mec-8 and unc-52 protein homolog 1 from Arabidopsis with 87.16% of identity
• Eggnog: Smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans)(ENOG410XP39)
• Kegg: Link to kegg annotations (AT1G73720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414864.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;