Protein coding transcript 120847

• Transcript: Ll_transcript_487256
• CDS coordinates: 1-1398 (+)
• Peptide sequence: ENNFTGSIPKSLGQNGKLTLVDLSSNKLTGSLPPDLCFGQKLQTLITLGNFLFGPIPGSLGKCESLTRIRMGDNFLNGSIPKGLFGLPKLTQVELQDNLLSGNFPDSGSISPNLGQITLSDNQLYGPLPPSIGNFTSMQKLLLDGNKFSGPIPPQIGRLQQLSKMDFSHNKFSGPIAKEISHCKLLTFVDLSRNELSGEIPKEIKYMRILNYLNISRNHLVGTIPGSIAAMQSLTSVDFSYNNLSGLVPGTGQFSYFNYTSFLGNPDLCGPYLVPCKDGVANGAHRPHVKGPLSPSFKLLLVIGLLVCSIAFAVAAILKARSLKKASKARAWKLTAFQRLEFTVEDVLDCLKDDNIIGKGGAGIVYKGAMPNGDHVAVKRLPAMSRGSSHDHGFNAEIQTLGRIRHRHIVRLLGFCSNHETNLLVYEYMPNGSLGEVLHGKKGGHLHWDTRYNVAVEAAKGLCYLH
• ORF Type: internal

Annotations of Ll_transcript_487256

• Blastp: Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 from Arabidopsis with 84.76% of identity
• Blastx: Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 from Arabidopsis with 84.76% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G65700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445962.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;